PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn344551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 188aa    MW: 21533.9 Da    PI: 6.5184
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn344551genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18e-2882135255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prl Wtp LH++Fv+a+e+LGG++kAtPk il+lm+vk L+++hvkSHLQ  Rl
  Achn344551  82 PRLWWTPHLHHSFVHAIEKLGGQDKATPKLILQLMDVKELSIAHVKSHLQEKRL 135
                 8*************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-2678137IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2182136IPR006447Myb domain, plants
SuperFamilySSF466891.36E-1382138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSEGMEIQDD KKKERNEEQH ENGSSSVSSQ KFSSFDLNEE ANNSEDDDCN KKEDLANGNR  60
TTLREGNERK TTTRQYVRSN MPRLWWTPHL HHSFVHAIEK LGGQDKATPK LILQLMDVKE  120
LSIAHVKSHL QEKRLKHEER LLDLKLRLSE SVGNNEERPT YGNNMQEINT VLSLSLSPYS  180
SSQTSKI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316821.16e-44myb family transcription factor family protein
TrEMBLA0A067GRA69e-44A0A067GRA6_CITSI; Uncharacterized protein
TrEMBLB9I1K76e-44B9I1K7_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0011s07270.12e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.11e-27G2-like family protein